GJC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJC2 antibody: synthetic peptide directed towards the middle region of human GJC2. Synthetic peptide located within the following region: APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	gap junction protein gamma 2
Database Link	NP_065168 Entrez Gene 57165 Human UniProt ID Q5T442
Background	This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains.This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects inThis gene areThe cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1. [provided by RefSeq, Jul 2008]
Synonyms	CX46.6; Cx47; GJA12; HLD2; LMPH1C; PMLDAR; SPG44
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%
Reference Data
Protein Families	Ion Channels: Other

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.