GJC1 (GJD3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the N terminal of human GJC1. Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	gap junction protein delta 3
Database Link	NP_689343 Entrez Gene 125111 Human UniProt ID Q8N144
Background	This gene is a member ofThe large family of connexins that are required forThe formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, onThe cell surface.This connexon can interact with a connexon from a neighboring cell, thus forming a channel linkingThe cytoplasm ofThe 2 cells. [provided by RefSeq, Jul 2008]
Synonyms	Cx30.2; CX31.9; GJA11; GJC1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.