GJB4 Rabbit Polyclonal Antibody

CAT#: TA341676

Rabbit Polyclonal Anti-GJB4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of gap junction protein, beta 4, 30.3kDa (GJB4)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GJB4 antibody: synthetic peptide directed towards the middle region of human GJB4. Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 29 kDa
Gene Name gap junction protein beta 4
Background This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations inThis gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]
Synonyms CX30.3; EKV
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Rat: 92%; Bovine: 92%; Mouse: 86%
Reference Data
Protein Families Ion Channels: Other, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...