MCM3 Rabbit Polyclonal Antibody
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | IHC, WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 91 kDa |
Gene Name | minichromosome maintenance complex component 3 |
Database Link | |
Background | The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are involved inThe initiation of eukaryotic genome replication.The hexameric protein complex formed by MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.This protein is a subunit ofThe protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46.This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase.The acetylation ofThis protein inhibitsThe initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2012] |
Synonyms | HCC5; P1-MCM3; P1.h; RLFB |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Yeast: 82% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cell cycle, DNA replication |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |