Annexin A10 (ANXA10) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANXA10 antibody: synthetic peptide directed towards the middle region of human ANXA10. Synthetic peptide located within the following region: VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	annexin A10
Database Link	NP_009124 Entrez Gene 11199 Human UniProt ID Q9UJ72
Background	This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in signal transduction pathways.The function ofThis gene has not yet been determined. [provided by RefSeq, Jul 2008]
Synonyms	ANX14
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.