KCNRG Rabbit Polyclonal Antibody
CAT#: TA341722
Rabbit Polyclonal Anti-KCNRG Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNRG antibody: synthetic peptide directed towards the N terminal of human KCNRG. Synthetic peptide located within the following region: MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | potassium channel regulator |
Database Link | |
Background | This gene encodes a protein which regulatesThe activity of voltage-gated potassium channels.This gene is on chromosome 13 and overlapsThe gene for tripartite motif containing 13 onThe same strand. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Feb 2012] |
Synonyms | DLTET |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |