CACNB4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	calcium voltage-gated channel auxiliary subunit beta 4
Database Link	NP_000717 Entrez Gene 785 Human UniProt ID O00305
Background	This gene encodes a member ofThe beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediateThe influx of calcium ions intoThe cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each ofThese subunits exist, either expressed from similar genes orThe result of alternative splicing.The protein encoded byThis locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controllingThe alpha-1 subunit membrane targeting and shiftingThe voltage dependence of activation and inactivation. Certain mutations inThis gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009]
Synonyms	CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Other
Protein Pathways	Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.