MEPE Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MEPE antibody: synthetic peptide directed towards the middle region of human MEPE. Synthetic peptide located within the following region: LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	matrix extracellular phosphoglycoprotein
Database Link	NP_064588 Entrez Gene 56955 Human UniProt ID Q9NQ76
Background	This gene encodes a secreted calcium-binding phosphoprotein that belongs toThe small integrin-binding ligand, N-linked glycoprotein (SIBLING) family of proteins. Members ofThis family are components ofThe extracellular matrix of bone and dentin and regulate bone mineralization. Deficiency of a similar protein in mouse results in increased bone mass. Mice lackingThis gene are resistant to aging-related trabecular bone loss. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Synonyms	OF45
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.