MDC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MDC1 antibody: synthetic peptide directed towards the C terminal of human MDC1. Synthetic peptide located within the following region: GKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	227 kDa
Gene Name	mediator of DNA damage checkpoint 1
Database Link	NP_055456 Entrez Gene 9656 Human UniProt ID Q14676
Background	The protein encoded byThis gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence.The encoded protein is required to activateThe intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage.This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment ofThe ATM kinase and meiotic recombination 11 protein complex to DNA damage foci. [provided by RefSeq, Jul 2008]
Synonyms	NFBD1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Dog: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.