Drgx Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Prrxl1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Prrxl1. Synthetic peptide located within the following region: MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFALQQLEALEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	dorsal root ganglia homeobox
Database Link	NP_665710 Entrez Gene 252880 Rat UniProt ID Q62798
Background	paired homeodomain protein; may be involved in regulating sensory neuron synapse formation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: U29174.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS070537, SRS070538 [ECO:0000348] ##Evidence-Data-END##
Synonyms	DRG11; PRRXL1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Human: 93%; Rabbit: 86%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.