Arntl Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Arntl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arntl. Synthetic peptide located within the following region: GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	aryl hydrocarbon receptor nuclear translocator-like
Database Link	NP_031515 Entrez Gene 11865 Mouse UniProt ID Q9WTL8
Background	The protein encoded byThis gene is a basic helix-loop-helix protein that forms a heterodimer with Clock.This heterodimer binds E-box enhancer elements upstream of Period (Per1, Per2, Per3) and Cryptochrome (Cry1, Cry2) genes and activates transcription ofThese genes. Per and Cry proteins heterodimerize and repressTheir own transcription by interacting in a feedback loop with Clock/Arntl complexes. Defects inThis gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2014]
Synonyms	bHLHe5; BMAL1; BMAL1c; JAP3; MGC47515; MOP3; PASD3; TIC
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 87%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.