Nkx3-2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Bapx1 antibody: synthetic peptide directed towards the N terminal of mouse Bapx1. Synthetic peptide located within the following region: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	NK3 homeobox 2
Database Link	NP_031550 Entrez Gene 579 Human UniProt ID P97503
Background	Bapx1 acts as a negative regulator of chondrocyte maturation.The constitutive RelA activation mediated by Bapx1 controls chondrocyte viability.
Synonyms	BAPX1; NKX3.2; NKX3B; SMMD
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Human: 93%; Zebrafish: 85%; Rat: 83%; Horse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.