EGR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Mouse, Xenopus
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	early growth response 1
Database Link	NP_001955 Entrez Gene 13653 Mouse UniProt ID P18146
Background	Transcriptional regulator. Recognizes and binds toThe DNA sequence 5'-CGCCCCCGC-3'(EGR-site). ActivatesThe transcription of target genes whose products are required for mitogenesis and differentiation.
Synonyms	AT225; G0S30; KROX-24; NGFI-A; TIS8; ZIF-268; ZNF225
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 92%; Bovine: 92%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Prion diseases

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.