E74 like factor 1 (ELF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of mouse ELF1. Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	E74 like ETS transcription factor 1
Database Link	NP_001138825 Entrez Gene 13709 MouseEntrez Gene 1997 Human UniProt ID P32519
Background	Transcription factor that activatesThe LYN and BLK promoters.
Synonyms	E74-like factor 1 (ets domain transcription factor); OTTHUMP00000018310
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 88%; Human: 87%; Rabbit: 87%; Dog: 80%; Horse: 80%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.