GCM1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gcm1 antibody: synthetic peptide directed towards the N terminal of mouse Gcm1. Synthetic peptide located within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	glial cells missing homolog 1
Database Link	NP_003634 Entrez Gene 14531 Mouse UniProt ID Q9NP62
Background	Transcription factor that is necessary for placental development
Synonyms	GCMA; hGCMa
Note	Immunogen Sequence Homology: Mouse: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 86%; Human: 86%; Zebrafish: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.