IRF1 Rabbit Polyclonal Antibody

CAT#: TA341785

Rabbit Polyclonal Anti-Irf1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of interferon regulatory factor 1 (IRF1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human interferon regulatory factor 1 (IRF1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human interferon regulatory factor 1 (IRF1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 37 kDa
Gene Name interferon regulatory factor 1
Background Irf1 specifically binds toThe upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes.Irf1 acts as a tumor suppressor.
Synonyms IRF-1; MAR
Note Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Sheep: 85%; Bovine: 85%; Rabbit: 85%; Dog: 83%; Horse: 83%; Human: 83%; Yeast: 83%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...