NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Nkx2-3 antibody: synthetic peptide directed towards the c terminal of mouse Nkx2-3. Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	NK2 homeobox 3
Database Link	NP_660328 Entrez Gene 18089 Mouse UniProt ID Q8TAU0
Background	Nkx2-3 is a transcriptional regulator essential for normal development and functions ofThe small intestine and spleen.Nkx2-3 activates directly MADCAM1 expression.Nkx2-3 is required for homing of lymphocytes in spleen and mucosa-associated lymphoid tissue. Nkx2-3 may have a role during pharyngeal organogenesis.
Synonyms	CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 87%; Human: 87%; Bovine: 87%; Guinea pig: 87%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.