Rel B (RELB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of mouse RELB. Synthetic peptide located within the following region: FLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	RELB proto-oncogene, NF-kB subunit
Database Link	NP_006500 Entrez Gene 5971 Human UniProt ID Q01201
Background	RelB is a member ofThe Rel/nuclear factor (NF)-kappa B family of transcription factors, defects in RelB affects antigen presenting cells andThe formation of lymphoid organs. Targeted disruption ofThe Rel/NF-kappaB family members NF-kappaB2, encoding p100/p52, and RelB in mice results in anatomical defects of secondary lymphoid tissues.
Synonyms	I-REL; IREL; REL-B
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	MAPK signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.