SIN3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIN3B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	105 kDa
Gene Name	SIN3 transcription regulator family member B
Database Link	NP_056075 Entrez Gene 20467 Mouse UniProt ID O75182
Background	Sin3B is one ofThe Sin3 co-repressors act as a protein scaffold to recruit transcription factors via its four highly homologous paired amphipathic helix (PAH) domains.
Synonyms	KIAA0700
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Human: 86%; Bovine: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.