emopamil binding protein (EBP) Rabbit Polyclonal Antibody

CAT#: TA341847

Rabbit Polyclonal Anti-EBP Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of emopamil binding protein (sterol isomerase) (EBP)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human emopamil binding protein (sterol isomerase) (EBP), 20 µg
    • 20 ug

CNY 2,900.00


Recombinant protein of human emopamil binding protein (sterol isomerase) (EBP), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-EBP antibody: synthetic peptide directed towards the N terminal of human EBP. Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 26 kDa
Gene Name emopamil binding protein (sterol isomerase)
Background The protein encoded byThis gene is an integral membrane protein ofThe endoplasmic reticulum. It is a high affinity binding protein forThe antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil andThe photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins inThe endoplasmic reticulum of different tissues.This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved inThe transport of cationic amphiphilics. Another prominent feature ofThis protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments.These aromatic amino acid residues have been suggested to be involved inThe drug transport byThe P-glycoprotein. Mutations inThis gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). [provided by RefSeq, Jul 2008]
Synonyms CDPX2; CHO2; CPX; CPXD
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Steroid biosynthesis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...