KDELR3 Rabbit Polyclonal Antibody

CAT#: TA341866

Rabbit Polyclonal Anti-KDELR3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3 (KDELR3), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3. Synthetic peptide located within the following region: AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name KDEL endoplasmic reticulum protein retention receptor 3
Background This gene encodes a member ofThe KDEL endoplasmic reticulum protein retention receptor family. Retention of resident soluble proteins inThe lumen ofThe endoplasmic reticulum (ER) is achieved in both yeast and animal cells byTheir continual retrieval fromThe cis-Golgi, or a pre-Golgi compartment. Sorting ofThese proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae.This process is mediated by a receptor that recognizes, and bindsThe tetrapeptide-containing protein, and returns it toThe ER. In yeast,The sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs ofThe ERD2 gene, constitutingThe KDEL receptor gene family, have been described. KDELR3 wasThe third member ofThe family to be identified. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Synonyms ERD2L3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 92%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Vibrio cholerae infection
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...