Nurim (NRM) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NRM antibody: synthetic peptide directed towards the N terminal of human NRM. Synthetic peptide located within the following region: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	nurim (nuclear envelope membrane protein)
Database Link	NP_009174 Entrez Gene 11270 Human UniProt ID Q8IXM6
Background	The protein encoded byThis gene contains transmembrane domains and resides withinThe inner nuclear membrane, where it is tightly associated withThe nucleus.This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
Synonyms	NRM29
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.