ATP1B4 Rabbit Polyclonal Antibody
CAT#: TA341890
Rabbit Polyclonal Anti-ATP1B4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ATP1B4 antibody: synthetic peptide directed towards the middle region of human ATP1B4. Synthetic peptide located within the following region: ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | ATPase Na+/K+ transporting family member beta 4 |
Database Link | |
Background | This gene has been found in all vertebrate genomes sequenced to date. However,This gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species,This gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals,The encoded protein interacts withThe nuclear transcriptional coregulator SKIP and may be involved inThe regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2010] |
Synonyms | (Na+); ATPase; beta 4 polypeptide; K+ transporting; K-ATPase beta-m subunit; OTTHUMP00000023940; X |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Cardiac muscle contraction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |