ATP1B4 Rabbit Polyclonal Antibody

CAT#: TA341890

Rabbit Polyclonal Anti-ATP1B4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ATP1B4 antibody: synthetic peptide directed towards the middle region of human ATP1B4. Synthetic peptide located within the following region: ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 41 kDa
Gene Name ATPase Na+/K+ transporting family member beta 4
Background This gene has been found in all vertebrate genomes sequenced to date. However,This gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species,This gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals,The encoded protein interacts withThe nuclear transcriptional coregulator SKIP and may be involved inThe regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2010]
Synonyms (Na+); ATPase; beta 4 polypeptide; K+ transporting; K-ATPase beta-m subunit; OTTHUMP00000023940; X
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane
Protein Pathways Cardiac muscle contraction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...