C20orf103 (LAMP5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C20orf103 antibody: synthetic peptide directed towards the middle region of human C20orf103. Synthetic peptide located within the following region: CQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDERE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	lysosomal associated membrane protein family member 5
Database Link	NP_036393 Entrez Gene 24141 Human UniProt ID Q9UJQ1
Background	The exact function of C20orf103 remains unknown.
Synonyms	BAD-LAMP; BADLAMP; C20orf103; LAMP-5; UNC-43
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 82%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.