CMT (ICMT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ICMT antibody: synthetic peptide directed towards the middle region of human ICMT. Synthetic peptide located within the following region: GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	isoprenylcysteine carboxyl methyltransferase
Database Link	NP_036537 Entrez Gene 23463 Human UniProt ID O60725
Background	This gene encodesThe third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins toThe cell membrane.This enzyme localizes toThe endoplasmic reticulum. Alternative splicing may result in other transcript variants, butThe biological validity of those transcripts has not been determined. [provided by RefSeq, Jul 2008]
Synonyms	HSTE14; MST098; MSTP098; PCCMT; PCMT; PPMT
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Yeast: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.