ALG6 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 58 kDa |
Gene Name | ALG6, alpha-1,3-glucosyltransferase |
Database Link | |
Background | This gene encodes a member ofThe ALG6/ALG8 glucosyltransferase family.The encoded protein catalyzesThe addition ofThe first glucose residue toThe growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations inThis gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008] |
Synonyms | CDG1C |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |