POMT2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	84 kDa
Gene Name	protein O-mannosyltransferase 2
Database Link	NP_037514 Entrez Gene 29954 Human UniProt ID Q9UKY4
Background	The protein encoded byThis gene is an O-mannosyltransferase that requires interaction withThe product ofThe POMT1 gene for enzymatic function.The encoded protein is found inThe membrane ofThe endoplasmic reticulum. Defects inThis gene are a cause of Walker-Warburg syndrome (WWS). [provided by RefSeq, Oct 2008]
Synonyms	LGMD2N; MDDGA2; MDDGB2; MDDGC2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 85%
Reference Data
Protein Families	Transmembrane
Protein Pathways	O-Mannosyl glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.