PCDHA4 Rabbit Polyclonal Antibody
CAT#: TA341926
Rabbit Polyclonal Anti-PCDHA4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PCDHA4 antibody: synthetic peptide directed towards the C terminal of human PCDHA4. Synthetic peptide located within the following region: SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 99 kDa |
Gene Name | protocadherin alpha 4 |
Database Link | |
Background | This gene is a member ofThe protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.The alpha gene cluster is composed of 15 cadherin superfamily genes related toThe mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes inThe cluster.The large, uninterrupted N-terminal exons each encode six cadherin ectodomains whileThe C-terminal exons encodeThe cytoplasmic domain.These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role inThe establishment and function of specific cell-cell connections inThe brain. Alternative splicing has been observed and additional variants have been suggested butTheir full-length nature has yet to be determined. [provided by RefSeq, Jul 2008] |
Synonyms | CNR1; CNRN1; CRNR1; PCDH-ALPHA4 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |