BMP10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Bmp10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	bone morphogenetic protein 10
Database Link	NP_055297 Entrez Gene 500245 Rat UniProt ID O95393
Background	Bmp10 is required for maintainingThe proliferative activity of embryonic cardiomyocytes by preventing premature activation ofThe negative cell cycle regulator CDKN1C/p57KIP and maintainingThe required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Bmp10 acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Bmp10 inhibits endothelial cell migration and growth.
Synonyms	MGC126783
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.