LAPTM4A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LAPTM4A antibody: synthetic peptide directed towards the middle region of human LAPTM4A. Synthetic peptide located within the following region: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	lysosomal protein transmembrane 4 alpha
Database Link	NP_055528 Entrez Gene 9741 Human UniProt ID Q15012
Background	This gene encodes a protein that has four predicted transmembrane domains.The function ofThis gene has not yet been determined; however, studies inThe mouse homolog suggest a role inThe transport of small molecules across endosomal and lysosomal membranes. [provided by RefSeq, Jul 2008]
Synonyms	HUMORF13; LAPTM4; MBNT; Mtrp
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Lysosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.