Seladin 1 (DHCR24) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the middle region of human DHCR24. Synthetic peptide located within the following region: AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	24-dehydrocholesterol reductase
Database Link	NP_055577 Entrez Gene 1718 Human UniProt ID Q15392
Background	This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzesThe reduction ofThe delta-24 double bond of sterol intermediates during cholesterol biosynthesis.The protein contains a leader sequence that directs it toThe endoplasmic reticulum membrane. Missense mutations inThis gene have been associated with desmosterolosis. Also, reduced expression ofThe gene occurs inThe temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. [provided by RefSeq, Jul 2008]
Synonyms	DCE; Nbla03646; seladin-1; SELADIN1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency, Transmembrane
Protein Pathways	Metabolic pathways, Steroid biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.