ST2 (IL1RL1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IL1RL1 antibody: synthetic peptide directed towards the N terminal of human IL1RL1. Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	interleukin 1 receptor like 1
Database Link	NP_057316 Entrez Gene 9173 Human UniProt ID Q01638
Background	The protein encoded byThis gene is a member ofThe interleukin 1 receptor family. Studies ofThe similar gene in mouse suggested thatThis receptor can be induced by proinflammatory stimuli, and may be involved inThe function of helper T cells.This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing ofThis gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Synonyms	DER4; FIT-1; IL33R; ST2; ST2L; ST2V; T1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 79%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.