PTPLAD1 (HACD3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTPLAD1 antibody: synthetic peptide directed towards the N terminal of human PTPLAD1. Synthetic peptide located within the following region: WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	3-hydroxyacyl-CoA dehydratase 3
Database Link	NP_057479 Entrez Gene 51495 Human UniProt ID Q9P035
Background	PTPLAD1 is a multi-pass membrane protein. It belongs toThe PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication andThe propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading toThe modulation of gene expression.
Synonyms	B-IND1; BIND1; HSPC121; PTPLAD1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.