TMEM138 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM138 antibody: synthetic peptide directed towards the N terminal of human TMEM138. Synthetic peptide located within the following region: MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	transmembrane protein 138
Database Link	NP_057548 Entrez Gene 51524 Human UniProt ID Q9NPI0
Background	This gene encodes a multi-pass transmembrane protein. Reduced expression ofThis gene in mouse fibroblasts causes short cilia and failure of ciliogenesis. Expression ofThis gene is tightly coordinated with expression ofThe neighboring gene TMEM216. Mutations inThis gene are associated withThe autosomal recessive neurodevelopmental disorder Joubert Syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]
Synonyms	HSPC196
Note	Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%; Rat: 79%; Goat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Rabbit: 79%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.