CNNM2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CNNM2 antibody: synthetic peptide directed towards the middle region of human CNNM2. Synthetic peptide located within the following region: EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	96 kDa
Gene Name	cyclin and CBS domain divalent metal cation transport mediator 2
Database Link	NP_060119 Entrez Gene 54805 Human UniProt ID Q9H8M5
Background	This gene encodes a member ofThe ancient conserved domain containing protein family. Members ofThis protein family contain a cyclin box motif and have structural similarity toThe cyclins.The encoded protein may play an important role in magnesium homeostasis by mediatingThe epithelial transport and renal reabsorption of Mg2+. Mutations inThis gene are associated with renal hypomagnesemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Dec 2011]
Synonyms	ACDP2; HOMG6; HOMGSMR
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.