BPNT2 Rabbit Polyclonal Antibody
CAT#: TA342036
Rabbit Polyclonal Anti-IMPAD1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the middle region of human IMPAD1. Synthetic peptide located within the following region: TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | inositol monophosphatase domain containing 1 |
Database Link | |
Background | This gene encodes a member ofThe inositol monophosphatase family.The encoded protein is localized toThe Golgi apparatus and catalyzesThe hydrolysis of phosphoadenosine phosphate (PAP) to adenosine monophosphate (AMP). Mutations inThis gene are a cause of GRAPP type chondrodysplasia with joint dislocations, and a pseudogene ofThis gene is located onThe long arm of chromosome 1. [provided by RefSeq, Dec 2011] |
Synonyms | GPAPP; IMP-3; IMP 3; IMPA3 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |