Selenoi Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Seli antibody is: synthetic peptide directed towards the N-terminal region of Rat Seli. Synthetic peptide located within the following region: FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	selenoprotein I
Database Link	NP_001128226 Entrez Gene 362713 Rat
Background	This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site.The selenocysteine is encoded byThe UGA codon that normally signals translation termination.The 3' UTR of selenoprotein genes have a common stem-loop structure,The sec insertion sequence (SECIS), that is necessary forThe recognition of UGA as a Sec codon rather than as a stop signal.
Synonyms	EPT1; hEPT1; KIAA1724; OTTHUMP00000200812
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.