RFT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1. Synthetic peptide located within the following region: GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	RFT1 homolog
Database Link	NP_443091 Entrez Gene 91869 Human UniProt ID Q96AA3
Background	N-glycosylation of proteins follows a highly conserved pathway that begins withThe synthesis of a¡¡Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate onThe cytoplasmic side ofThe endoplasmic reticulum (ER) membrane followed byThe translocation of Man(5)GlcNAc (2)-PP-Dol toThe luminal side ofThe ER membrane. RFT1 isThe flippase enzyme that catalyzesThis translocation.N-glycosylation of proteins follows a highly conserved pathway that begins withThe synthesis of a Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate onThe cytoplasmic side ofThe endoplasmic reticulum (ER) membrane followed byThe translocation of Man(5)GlcNAc (2)-PP-Dol toThe luminal side ofThe ER membrane. RFT1 isThe flippase enzyme that catalyzesThis translocation (Helenius et al., 2002 [PubMed 11807558]). [supplied by OMIM]
Synonyms	CDG1N
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 85%
Reference Data
Protein Families	Transmembrane
Protein Pathways	N-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.