FCRL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FCRL1 antibody: synthetic peptide directed towards the N terminal of human FCRL1. Synthetic peptide located within the following region: MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	Fc receptor like 1
Database Link	NP_443170 Entrez Gene 115350 Human UniProt ID Q96LA6
Background	FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation.
Synonyms	CD307a; FCRH1; IFGP1; IRTA5
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Horse: 83%; Mouse: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.