RFC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	replication factor C subunit 1
Database Link	NP_002904 Entrez Gene 89809 Rat UniProt ID P35251
Background	transcriptional repressor that regulates transcription ofThe vasoactive intestinal peptide receptor gene [RGD, Feb 2006]. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS160522, ERS240727 [ECO:0000348] ##Evidence-Data-END##
Synonyms	A1; MHCBFB; PO-GA; RECC1; RFC; RFC140
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	DNA replication, Mismatch repair, Nucleotide excision repair

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.