RFC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RFC1 antibody: synthetic peptide directed towards the middle region of human RFC1. Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	128 kDa
Gene Name	replication factor C subunit 1
Database Link	NP_002904 Entrez Gene 5981 Human UniProt ID P35251
Background	This gene encodesThe large subunit of replication factor C, a five subunit DNA polymerase accessory protein, which is a DNA-dependent ATPase required for eukaryotic DNA replication and repair.The large subunit acts as an activator of DNA polymerases, binds toThe 3' end of primers, and promotes coordinated synthesis of both strands. It may also have a role in telomere stability. Alternatively spliced transcript variants encoding different isoforms have been noted forThis gene. [provided by RefSeq, Mar 2011]
Synonyms	A1; MHCBFB; PO-GA; RECC1; RFC; RFC140
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	DNA replication, Mismatch repair, Nucleotide excision repair

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.