SH3BP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	SH3 domain binding protein 2
Database Link	NP_003014 Entrez Gene 6452 Human UniProt ID P78314
Background	The protein encoded byThis gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain.The protein binds toThe SH3 domains of several proteins includingThe ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations inThis gene result in cherubism. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009]
Synonyms	3BP-2; 3BP2; CRBM; CRPM; RES4-23
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Natural killer cell mediated cytotoxicity

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.