Sh3gl3 Rabbit Polyclonal Antibody
CAT#: TA342209
Rabbit polyclonal Anti-Sh3gl3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Sh3gl3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | SH3-domain GRB2-like 3 |
Database Link | |
Background | Implicated in endocytosis. May recruit other proteins to membranes with high curvature. |
Synonyms | CNSA3; EEN-2B-L3; EEN-B2; Endophilin-3; HsT19371; SH3D2C; SH3P13 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |