RAB1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAB1A antibody: synthetic peptide directed towards the middle region of human RAB1A. Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	RAB1A, member RAS oncogene family
Database Link	NP_004152 Entrez Gene 19324 MouseEntrez Gene 5861 Human UniProt ID P62820
Background	This gene encodes a member ofThe Ras superfamily of GTPases. Members ofThe gene family cycle between inactive GDP-bound and active GTP-bound forms.This small GTPase controls vesicle traffic fromThe endoplasmic reticulum toThe Golgi apparatus. Multiple alternatively spliced transcript variants have been identified forThis gene which encode different protein isoforms. [provided by RefSeq, Oct 2008]
Synonyms	RAB1; YPT1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.