RAB27A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	RAB27A, member RAS oncogene family
Database Link	NP_004571 Entrez Gene 5873 Human UniProt ID P51159
Background	The protein encoded byThis gene belongs toThe small GTPase superfamily, Rab family.The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations inThis gene are associated with Griscelli syndrome type 2. Alternative splicing occurs atThis locus and four transcript variants encodingThe same protein have been identified. [provided by RefSeq, Jul 2008]
Synonyms	GS2; HsT18676; RAB27; RAM
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Goat: 79%; Horse: 79%; Sheep: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.