MYBPH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYBPH antibody: synthetic peptide directed towards the middle region of human MYBPH. Synthetic peptide located within the following region: APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	myosin binding protein H
Database Link	NP_004988 Entrez Gene 4608 Human UniProt ID Q13203
Background	Binds to myosin; probably involved in interaction with thick myofilaments inThe A-band.
Synonyms	myosin-binding protein H; myosin binding protein H; OTTHUMP00000039086
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.