MYBPH Rabbit Polyclonal Antibody
CAT#: TA342226
Rabbit polyclonal Anti-MYBPH Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MYBPH antibody: synthetic peptide directed towards the middle region of human MYBPH. Synthetic peptide located within the following region: APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | myosin binding protein H |
Database Link | |
Background | Binds to myosin; probably involved in interaction with thick myofilaments inThe A-band. |
Synonyms | myosin-binding protein H; myosin binding protein H; OTTHUMP00000039086 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Zebrafish: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |