Zbtb7a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the N terminal of mouse ZBTB7A. Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	zinc finger and BTB domain containing 7a
Database Link	NP_034861 Entrez Gene 16969 Mouse UniProt ID O88939
Background	The function of Anti-ZBTB7A has not yet been determined.
Synonyms	DKFZp547O146; FBI-1; FBI1; LRF; MGC99631; pokemon; TIP21; ZBTB7; ZNF857A
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.