MSC Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Msc antibody: synthetic peptide directed towards the C terminal of mouse Msc. Synthetic peptide located within the following region: IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	musculin
Database Link	NP_005089 Entrez Gene 17681 Mouse UniProt ID O60682
Background	Transcription repressor that blocks myogenesis and activation of E-box dependent muscle genes.
Synonyms	ABF-1; ABF1; bHLHa22; MYOR
Note	Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.