Srebf1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of mouse SREBF1. Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	125 kDa
Gene Name	sterol regulatory element binding transcription factor 1
Database Link	NP_035610 Entrez Gene 20787 Mouse UniProt ID Q9WTN3
Background	Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Srebf1 also binds to an E-box motif (5'-ATCACGTGA-3'). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.
Synonyms	bHLHd1; SREBP-1; SREBP-1c; SREBP1
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.