Activator of basal transcription 1 (ABT1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the middle region of mouse Abt1. Synthetic peptide located within the following region: RQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	activator of basal transcription 1
Database Link	NP_037507 Entrez Gene 30946 Mouse UniProt ID Q9ULW3
Background	Could be a novel TATA-binding protein (TBP) which can function as a basal transcription activator. Can act as a regulator of basal transcription for class II genes.
Synonyms	hABT1
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%; Horse: 83%; Human: 83%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.